PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015876516.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB
Protein Properties Length: 231aa    MW: 26384.4 Da    PI: 7.1638
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015876516.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.96.5e-101760344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     rWT  Ed+l+ +a  ++  +   +W++Ia+ ++ gR++ ++ +++
   XP_015876516.1 17 RWTRYEDKLFEQALVRFSEDlpdRWEKIAQQLP-GRSPSDVMEHY 60
                     9*****************99*************.**********9 PP

2Myb_DNA-binding452.5e-14116160347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + +q+G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_015876516.1 116 PWTEEEHRKFLLGLQQFGKGDWRSISRNVVITRTPTQVASHAQKY 160
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.6151367IPR017884SANT domain
SMARTSM007172.7E-81466IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-71664IPR009057Homeodomain-like
SuperFamilySSF466891.42E-121672IPR009057Homeodomain-like
CDDcd001676.32E-81764No hitNo description
PfamPF002493.4E-81761IPR001005SANT/Myb domain
PROSITE profilePS5129417.657109165IPR017930Myb domain
SuperFamilySSF466892.07E-17111166IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-18112164IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-11113159IPR009057Homeodomain-like
SMARTSM007174.9E-12113163IPR001005SANT/Myb domain
CDDcd001676.93E-10116161No hitNo description
PfamPF002491.3E-12116160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MYQDNSCWAM IQSASTRWTR YEDKLFEQAL VRFSEDLPDR WEKIAQQLPG RSPSDVMEHY  60
EALVHDVFEI DSGRVQLPSY ADDSFGLSRW DSASQISFGS KPKQQGGEPE RKKGTPWTEE  120
EHRKFLLGLQ QFGKGDWRSI SRNVVITRTP TQVASHAQKY FLRQNSVKKE RKRSSIHDIT  180
SAETNSVPMS ADQNWIPPPG GQPLPLQQLP PTGHMPDQGA SLGYQNFSFP M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-151480273RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015876516.11e-173PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5WIS81e-119M5WIS8_PRUPE; Uncharacterized protein
STRINGGLYMA10G42450.11e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.17e-77MYB family protein